Peptides

    1 - 10 of 10

    GLP-1 (7-36), amide, human, mouse, rat, bovine, guinea pig, Biotin-labeled

    • Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
    • Cat.Number : AS-23586

    Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human [FAM-Trp31] - 0.5 mg

    • HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
    • Cat.Number : AS-64488

    Glucagon-Like Peptide-2, GLP-2 (1-33), human - 1 mg

    • HADGSFSDEMNTILDNLAARDFINWLIQTKITD
    • Cat.Number : AS-62070

    Glucagon-Like Peptide-2, GLP-2 (1-34), human - 1 mg

    • HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
    • Cat.Number : AS-62068
      1 - 10 of 10